PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00004618-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 355aa    MW: 40606.4 Da    PI: 6.2397
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00004618-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-092823172055
                            HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
               Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                            +k +yps++e+  LA+++gL+++q+ +WF N+R ++
  SMil_00004618-RA_Salv 282 YKWPYPSESEKVALADSTGLDQKQINNWFINQRKRH 317
                            4679*****************************885 PP

2ELK36.11.4e-12237258122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELK++Ll+KYsgyL+sLkqE+s
  SMil_00004618-RA_Salv 237 ELKNHLLKKYSGYLSSLKQELS 258
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012556.6E-2192136IPR005540KNOX1
PfamPF037904.6E-2294135IPR005540KNOX1
SMARTSM012563.6E-27144195IPR005541KNOX2
PfamPF037916.6E-24149194IPR005541KNOX2
SMARTSM011881.0E-6237258IPR005539ELK domain
PfamPF037896.9E-10237258IPR005539ELK domain
PROSITE profilePS5121311.243237257IPR005539ELK domain
PROSITE profilePS5007112.957257320IPR001356Homeobox domain
SuperFamilySSF466891.24E-19258332IPR009057Homeodomain-like
SMARTSM003892.6E-13259324IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-27262323IPR009057Homeodomain-like
CDDcd000869.18E-12269321No hitNo description
PfamPF059201.1E-16277316IPR008422Homeobox KN domain
PROSITE patternPS000270295318IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001708Biological Processcell fate specification
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010089Biological Processxylem development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MEEYNLQLSE DANSRGGAFV YRGGPVLAGS SSIYARGGSF HLQSGDCYEH GAVVKTEAGT  60
SQNHAPRFQY PSHENLHDHH HHQTQTNPIQ VDVIKAKIIA HPQYSNLLEA YMDCQKVGAP  120
AEVVARLTAV REEFEARQVA TGASRDEYSK DPELDQFMEA YYDMLVKYRE ELTRPLQEAM  180
EFMRRIESQL NLLTNAPLRI FNSEEKSEGI GSSEEEQDNS GGETGVAEID PRAEDRELKN  240
HLLKKYSGYL SSLKQELSKK KKKGKLPKEA RQKLLSWWEL HYKWPYPSES EKVALADSTG  300
LDQKQINNWF INQRKRHWKP SEDMQFMVMD GLHPQNAALY MDGHYMPDAP YRLGP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074319.10.0PREDICTED: homeotic protein knotted-1
SwissprotQ413301e-172KN1_SOLLC; Homeotic protein knotted-1
TrEMBLA0A061FMA10.0A0A061FMA1_THECC; KNOTTED-like from
STRINGVIT_18s0001g08380.t011e-177(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49732333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.11e-125KNOTTED-like from Arabidopsis thaliana